logo

Gratis

gratis product De beste Black Friday Aanbiedingen (Cyber-Weekend)
gratis producten
Dit overzicht wordt vandaag bijgewerkt.
In Amerika is het Black Friday (met absurde kortingen in de winkels). In Nederland doen nu steeds meer winkels mee met Black Friday / Cyber Monday. Wij hebben de beste acties verzameld:
Amac - 5% korting op Mac, iPad en accessoires
Blokker -
Bol.com - Diverse Black Friday Deals
BCC - 100 Unieke aanbiedingen
C&A - 20% korting op alles
Coolblue - Worden steeds meer aanbiedingen toegevoegd
Conrad - nog niet bekend
HEMA - Heel veel korting tot 50%
Intertoys - 15% korting op alles + speciale aanbiedingen
Pets Place - 20% korting op alles
MediaMarkt - Black Friday Super Sale
Wehkamp - Tot 60% korting op alles
Ziggo - Alles-in-1 6 maanden € 29,95
-
privacy
 
 
gratis product Gratis zakje Bolletje Spelt Kruidnoten t.w.v. € 2,29
gratis producten
Lever de bon in bij Primera en ontvang gratis 1 zakje 200gr Bolletje Spelt Kruidnoten t.w.v. € 2,29. Er zijn 3 varianten: Koffie, Hazelnoot en Cranberry. Inleveren kan t/m 26 november.
privacy
 
 
gratis product Gratis 100% NL Chocoladeletter
gratis producten
100% NL deelt luxe chocoladeletters uit: 24 nov in Dordrecht, 27 nov in Middelburg, 28 nov in Purmerend, 29 nov in Roermond, 30 nov in Meppel, 1 dec in Utrecht, 4 dec in Arnhem en 5 dec in Eindhoven. Je krijgt een chocoladeletter als je de gratis 100% NL App op je mobiel laat zien.
privacy
 
 
gratis product Gratis Schoen Zetten Sinterklaas
gratis producten
Dit jaar kan je meedoen met de volgende Sinterklaas acties:
AH (onderaan de pagina schoen zetten), Bibliotheek of Boekhandel (vouwschoen, met als cadeau het Schoenboekje van Tosca Menten), Boni (kleurplaat), Coop (schoenbouwplaat), DekaMarkt (knutselplaat), Dobey (voerbakje), Emté (knutselschoen), EP (digitale schoen), Formido (knutselschoen), Hoogvliet (knutselmijter), Intratuin (knutsellaarsje), Jan Linders (knutselpaat), Jumper (voerbakje zetten), Lidl (knutselschoen), MCD Supermarkten (knutselzak), Plus (knutselschoen), Poiesz (knutselstoomboot), Spar (bouwplaat), Vomar (pepernotenspeurtocht), Welkoop (knutselklomp).
privacy
 
 
gratis product Maak kans op een Amerikaanse Koelkast + Tips en Trucs
gratis producten
Je maakt kans op een Amerikaans Koelkast als je lid wordt van de Keuken Kampioen nieuwsbrief. Je blijft dan op de hoogte van de laatste tips en trends op gebied van keukens. Je kan ook het Gratis Keukenmagazine aanvragen, je maakt dan kans op een Samsung 50" TV.
privacy
 
 
gratis product Gratis Croissant bij Vomar
gratis producten
Vomar heeft het beste brood van Noord-Holland. Donderdag, vrijdag en zaterdag krijgt elke klant tot 10.00 een gratis croissant. De actie staat op de voorzijde van de folder.
privacy
 
 
gratis product Gratis parfumsample Lancôme La Vie est Belle
gratis producten
Lever deze waardebon uiterlijk 3 december in bij Douglas en ontvang een gratis parfumsample van Lancôme La Vie est Belle.
privacy
 
 
gratis product Gratis Schoen zetten bij LIDL
gratis producten
Vanaf 18 november kan je een knutselschoentje halen in de LIDL-winkels (of downloaden). Zet deze in elkaar, lever hem voor 5 december in en ontvang een verrassing van de Sint.
privacy
 
 
gratis product Gratis Zonnebril
gratis producten
In de folder van Xooon staat de wincode fall17 verstopt. Als je deze invult bij het inschrijfformulier maak je kans op een wooncheque t.w.v. € 1.500,-. Bovendien ontvang je direct een waardebon per e-mail waarmee je een gratis zonnebril kunt afhalen bij een winkel van Xooon.
privacy
 
 
gratis product Gratis leuke Verrassing + Kans op Robotstofzuiger t.w.v. € 399,-
gratis producten
Passen jij en ENGIE bij elkaar? Ontdek het zelf! Doe de test en ontvang gratis een leuke verrassing! Bovendien maak je ook kans op de Neato Botvac D3 Robotstofzuiger.
privacy
 
 
gratis product Gratis Suprise Dozen + Handleiding
gratis producten
Bij ALDI kan je gratis dozen + handleiding ophalen om er zelf een surprise van te maken. Maak in 9 simpele stappen een Sinterklaas of het paard Amerigo.
privacy
 
 
gratis product Gratis Smartphone Autosticker
gratis producten
Laat zien dat jij je in het verkeer niet laat afleiden door jouw smartphone. Vraag de gratis autosticker bij ZLM aan.
privacy
 
 
gratis product Maak een ander blij met je oude speelgoed
gratis producten
Bij een deelnemende Albert Heijn kan je een gratis Goedzak ophalen (ook bij je online boodschappen). Vul de Goedzak met speelgoed waarmee je een kind blij denkt te kunnen maken. De Goedzak komt dan terecht bij een lokaal goed doel. Je krijgt de Goedzak ook bij een online bestelling. Gratis bezorgen of ophalen bij diverse producten.
privacy
 
 
gratis product Gratis proefpakket TENA Lady Discreet (of ander product)
gratis producten
Vraag een gratis proefpakket aan van de nieuwe TENA Lady Discreet. Voorzien van microPROTEXTM technologie, waardoor het 20% dunner is en net zo veilig. Je kan ook kiezen voor een andere TENA Lady variant (inlegkruisjes, verbanden, pants/ondergoed). Door de vraag te beantwoorden ontdek je de producten die het meest geschikt voor jou zijn. Let erop dat je ook de korte vragenlijst invult, nadat je jouw gegevens hebt bevestigd. Pas dan ontvang je het proefpakket!
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je deze link proberen of de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis Bruna Cadeaukaart t.w.v. € 2,50 bij pakketje versturen
gratis producten
Verstuur je postpakket via PostNL bij Bruna en ontvang een Bruna Cadeaukaart t.w.v. € 2,50. Deze cadeaukaart is te besteden t/m 31 oktober 2018. Omdat de scholen weer zijn begonnen krijg je nu 50% korting op geselecteerde A-merk schoolspullen. Vanaf 20 euro wordt je bestelling gratis thuisbezorgd.
privacy
 
 
gratis product Gratis proefnummer (vernieuwde) Eva Magazine t.w.v. € 4,50
gratis producten
Eva Magazine is vernieuwd. Nu met nog meer ruimte voor eerlijke en kwetsbare verhalen, diepte-interviews, achtergronden en natuurlijk lekker veel lifestyle en fashion. Verder bijzondere en inspirerende artikelen over allerlei onderwerpen die vrouwen bezighouden, zoals geloofs- en levensvragen, maar ook rubrieken over mode, verzorging, koken, natuur en uitgaan. Vraag een gratis proefnummer aan.
privacy
 
 
gratis product Gratis Star Wars Magazine t.w.v. € 4,95
gratis producten
Reserveer je eigen Star Wars Magazine t.w.v. € 4,95 en haal deze vanaf 11 november op bij Primera. Het magazine bevat 80 pagina's met alles wat je moet weten over de nieuwste Star Wars-film. Er zijn 100.000 magazines beschikbaar.
privacy
 
 
gratis product Gratis zakje Fisherman's Friend Mint
gratis producten
Weer beschikbaar: Kies 3 vrienden en laat ze gratis een zakje Fisherman's Friend Mint aanvragen. Daarna kan je zelf een zakje aanvragen. Er zijn 10.000 zakjes beschikbaar. Mededeling: De actie werkt mogelijk niet via een mobiel of tablet, gebruik in dat geval een laptop of vaste computer.
privacy
 
 
gratis product Gratis Waardebepaling van jouw Woning
gratis producten
Weten wat jouw woning waard is? Ontvang binnen 48-uur gratis en vrijblijvend een waardebepaling van jouw woning. Dit wordt gebaseerd op kadastergegevens verkoopgegevens, gelijkwaardige te koop staande objecten (hier kijkt de koper ook naar), rapportage Calcasa en rapportage NBWO.
privacy
 
 
gratis product Gratis 1 maand meespelen Postcode Loterij
gratis producten
Speel de eerste maand gratis mee met de Postcode Loterij (600.000 prijzen per trekking). Maandelijks is een trekking. Iedere werkdag wint een hele postcode € 1.000,- per lot. Elke zaterdag verdeelt een hele postcode € 100.000,- en elke zondag wint een hele postcode € 25.000,- + BMW. Je speelt mee zolang je zelf wilt.
privacy
 
 
gratis product Gratis het boek 'Ik Robot' van Isaac Asimov
gratis producten
Dit jaar is robotica het thema van Nederland Leest (1 t/m 30 november). Geef je mening over 6 stellingen en ontvang gratis het boek 'Ik Robot' van Isaac Asimov bij de bibliotheek. Dit boek gaat over robots die een eeuw geleden al werden voorspeld, maar nu dan toch echt in groten getale komen. Er is ook een extra verhaal toegevoegd, dat Ronald Giphart samen met een robot schreef.
privacy
 
 
gratis product Gratis Tony's Chocolonely Verrassing op je verjaardag
gratis producten
Steun de missie van Tony's Chocolonely om chocolade 100% slaafvrij te maken door serieus vrienden te worden. Als je jarig bent krijg je een cadeautje van de chocopostbode.
privacy
 
 
gratis product Maak een proefrit in de nieuwe Renault CAPTUR (of vraag brochure aan)
gratis producten
Maak een proefrit in de nieuwe Renault CAPTUR. Als je de brochure wilt, moet je rechtsboven (nadat je een auto hebt gekozen) op 'Brochure' klikken. Proefrit staat standaard geselecteerd. Of kies voor een ander model: Twingo, Clio, Clio Estate Kadjar, Mégane, Mégane Estate, Scénic.
privacy
 
 
gratis product Gratis sample A.Vogel Linoforce
gratis producten
Linoforce van A.Vogel is een zuiver natuurlijk middel met Lijnzaad en Sennablad. Het helpt de ontlasting zachter te maken en bevordert de natuurlijke stoelgang en darmpassage. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
Pagina 1 van 14   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2017 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand