logo

De nieuwste gratis producten en spullen

gratis product Gratis proefpakket Platinum Hondenvoer
gratis producten
Het gratis proefpakket van Platinum Hondenvoer bestaat uit onze drie soorten Adult voeding en een aantal Fit-Sticks Chicken+Lamb. Platinum complete voeding bestaat voor ten minste 70% uit vers vlees en ruikt en smaakt naar vlees.
privacy
 
 
gratis product Gratis Maybelline Eye Shadow Color Show (500x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 500 deelnemers gratis Maybelline Eye Shadow Color Show uitproberen. Binnenkort kan je ook Tetley Green Tea Mojito (400x) en Ultima II Lipchrome Lipstick (450x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis Flexa Kleurtester t.w.v. € 1,99
gratis producten
Maak een account aan, log in en gebruik de code rtl om een gratis Flexa Kleurtester t.w.v. € 1,99 te bestellen (als je niet ingelogd bent, werkt de code niet). Werkt de kortingscode niet meer? Probeer het dan morgen opnieuw.
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Update 9 mei: Vanwege de vele sample aanvragen zijn ze tijdelijk door de sample voorraad heen. Er gaat nog een tweede ronde komen.
privacy
 
 
gratis product Gratis Primera Spaarpas + Verschillende Cadeautjes
gratis producten
Met de gratis Primera Spaarpas spaar je Primera punten over je aankopen (verkrijgbaar in de winkel). Je spaart voor een gratis 1/5 Staatslot of de helft in contanten. Gedurende 1 jaar tijd dat wij nu lid zijn hebben wij per e-mail waardebonnen gekregen voor: gratis winkelmagenmuntje, chocolade letter, kerstkaarten, tas, Autoweek special en punten op de verjaardag.
privacy
 
 
gratis product Maak kans op een 2-daagse Brouwcursus
winnen
Geef je op om kans te maken op een 2-daagse brouwcursus bij een van de deelnemende speciaalbierbrouwerijen. Je krijgt dan een rondleiding door de brouwerij, leer je alles over smaken, geuren en kleuren, hoe je bier brouwt én wat er mis kan gaan. Ook mag je proeven en ga je zelf aan de slag.
privacy
 
 
gratis product Gratis Huismerkproducten bij Plus Klantenpanel
gratis producten
Winkel je wel eens bij de Plus Supermarkt? Dan is het Plus Klantenpanel misschien wel iets voor jou. Er zijn 4-5 onderzoeken per jaar. De beloning is een huismerkproduct of kans op Plus cadeaukaarten.
privacy
 
 
gratis product Gratis Mentos Rainbow (350x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 350 deelnemers gratis Mentos Rainbow uitproberen. Binnenkort kan je ook Maybelline Eye Shadow Color Show (500x) en Ultima II Lipchrome Lipstick (450x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis proefnummer OKIDO t.w.v. € 3,99
gratis producten
Benieuwd naar het spiksplinternieuwe eerste nummer van OKIDO tijdschrift? Stuur dan een mailtje naar info@okidotijdschrift.nl met jouw naam en adres. Het tijdschrift komt dan zo snel mogelijk jouw kant op. Doelgroep: Kinderen tussen de 3 en 6 jaar.
privacy
 
 
gratis product Gratis Bourjois So Laque Nail Lacquer (400x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 400 deelnemers gratis Bourjois So Laque Nail Lacquer uitproberen. Binnenkort kan je ook Maybelline Eye Shadow Color Show (500x) en Mentos Rainbow (400x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Hoogste rente van NL op je Spaar- én Betaalrekening + Gratis Creditcard + Gratis € 50,-
geld verdienen
Besparen op je dure bankkosten, gratis extra rekeningen en een hoge rente op je spaar- én betaalrekening? Stap dan over naar Knab. Verder zijn de eerste 3 maanden gratis en als je wilt krijg je een gratis VISA Creditcard. Bevalt het niet? Knab is dagelijks opzegbaar. Als je al zeker weet dat je klant blijft kan je eventueel gebruik maken van de overstapservice, doe dit voor 31 mei 2017 en je krijgt € 50,- cadeau. Houd er rekening mee dat je de Overstapservice niet tussentijds kunt stopzetten, als je dit wel doet kost het € 125,-.
privacy
 
 
gratis product Gratis mooie bos Bloemen t.w.v. € 20,- bij TrosKompas
bijna gratis
Je krijgt gratis een Topbloemen Cadeaubon t.w.v. € 20,- bij een halfjaarabonnement op het TrosKompas voor maar € 15,-. Je kan dan zelf een mooie bos uitkiezen. Dit abonnement is tot wederopzegging, opzeggen kan eenvoudig per e-mail (abonneeservice@troskompas.nl).
privacy
 
 
gratis product Gratis Strategiespel StarCraft + Brood War uitbreiding
gratis producten
Het bekende strategiespel StarCraft is sinds vandaag gratis te downloaden, inclusief de uitbreiding Brood War. Dit strategiespel is geschikt voor zowel Windows als OS X.
privacy
 
 
gratis product Gratis Bausch+Lomb proefpakket ULTRA contactlenzen
gratis producten
Bausch+Lomb ULTRA contactlenzen met MoistureSeal technologie zijn de nieuwste maandlenzen die zelfs na 16 uur nog 95% van het vocht bevatten. Download de voucher en maak een vrijblijvende afspraak met de dichtstbijzijnde contactlensspecialist en ontvang een gratis proefpakket ULTRA contactlenzen.
privacy
 
 
gratis product Gratis RFID Kaarthouder
gratis producten
Deel via Facebook de post van XD Design op je eigen tijdlijn. Maak een printscreen en stuur deze samen met je adres naar bobby@xd-design.com om een gratis RFID Kaarthouder te ontvangen, deze beschermt je bankpas tegen skimmen.
privacy
 
 
gratis product Gratis 50 Fotoafdrukken
bijna gratis
Schrijf je in voor de nieuwsbrief van Webprint en ontvang gratis 50 fotoafdrukken. Je betaalt wel de verzend- en verwerkingskosten.
privacy
 
 
gratis product 20ct Korting op Brandstof tijdens Formule-1
korting
Tijdens de Formule-1 race(zon)dagen in 2017, profiteer je van 20ct per liter korting op brandstof bij TinQ (op Euro95 en Diesel).
privacy
 
 
gratis product Gratis Puntzak Friet
gratis producten
T/m 10 april 2018 mag iedereen, op vertoon van een identiteitsbewijs, op zijn eigen verjaardag een gevulde puntzak naar keuze ophalen bij een van de 31 vestigingen van Bram Ladage in Rotterdam, Schiedam, Capelle aan den IJssel, Vlaardingen, Ridderkerk, Hoogvliet, Oud-Beijerland, Delft, Spijkenisse, Zoetermeer, Rijswijk, Dordrecht, Gouda, Den Haag, Nieuwegein of Utrecht.
privacy
 
 
gratis product Gratis Taxatie van jouw auto (met persoonlijk inruilvoorstel)
gratis producten
Ontdek hoeveel geld jouw auto waard is als je deze zou inruilen bij een nieuwe Renault Twingo, Renault Clio of Renault Captur. Het is ook mogelijk om direct een offerte aan te vragen.
privacy
 
 
gratis product € 200,- Cashback bij Nuon 'Helemaal uit je stekker weken'
korting
Bij Nuon zijn het weer de 'Helemaal uit je stekker weken'. Stap over en ontvang nu tijdelijk € 200,- cashback bij het afsluiten van stroom en gas met een 1-jarig contract. Nuon regelt voor jou de overstap en vergoeden een eventuele overstapboete. Door deze cashback is Nuon een van de goedkoopste aanbieders.
privacy
 
 
gratis product Gratis Donald Duck
gratis producten
Lees nu tijdelijk gratis online de Donald Duck (nr. 3-2017). Je kan ook direct een voordelig (proef)abonnement afsluiten via deze link; het verschilt per proefabonnement of deze tot wederopzegging is of automatisch stopt.
privacy
 
 
gratis product Gratis proefnummer See All This t.w.v. € 12,50
gratis producten
See All This is hét kunstmagazine van Nederland, gedragen door alle vooraanstaande musea. Met aandacht voor oude en hedendaagse kunst, natuur, fotografie, literatuur, mode, eten en reizen. Vraag zolang de voorraad strekt een gratis proefnummer aan.
privacy
 
 
gratis product Maak kans op een Tankpas t.w.v. € 50,-
winnen
Wat weet jij over de risico's van schade en diefstal? Test jouw kennis en maak kans op een tankpas t.w.v. € 50,-.
privacy
 
 
gratis product Gratis Waardebepaling van jouw Woning
gratis producten
Weten wat jouw woning waard is? Ontvang 100% vrijblijvend een waardebepaling van jouw woning. Dit wordt gebaseerd op kadastergegevens verkoopgegevens na 2008, gelijkwaardige te koop staande objecten (hier kijkt de koper ook naar), rapportage Calcasa en rapportage NBWO.
privacy
 
 
gratis product Gratis Wegenwacht t.w.v. € 57,- (voor jongeren tot 25 jaar)
gratis producten
Ben je jonger dan 25 jaar en geslaagd voor je rijbewijs? Dan krijg je van de ANWB een jaar lang gratis Wegenwacht service met pechhulp in Nederland.
privacy
 
 
Pagina 7 van 19   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2017 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand