logo

De nieuwste gratis producten en spullen

gratis product Geld Terug Actie: Chaudfontaine Fusion
geld terug actie
Koop in de supermarkt een 0,5L of 1L fles Chaudfontaine Fusion (alle smaken). Na het insturen van de kassabon krijg je het aankoopbedrag terug op je rekening. De actieperiode loopt tot en met 31 oktober.
privacy
 
 
gratis product Gratis Lief Dier Magazine (nummer 2 - 2017)
gratis producten
Haal bij Pets Place gratis het nieuwe Lief Dier Magazine. In dit trendy magazine lees je allerlei leuke, informatieve verhalen, rubrieken, interviews en reportages die met honden, katten, konijnen, vogels, knagers en vissen te maken hebben. Ook bij online bestellingen krijg je gratis het Lief Dier Magazine.
privacy
 
 
gratis product Gratis proefsetje Acuvue Contactlenzen
gratis producten
Probeer gratis Acuvue Contactlenzen. Haal een gratis proefsetje bij een deelnemende opticien naar keuze. Informeer wel eerst bij je opticien of er nog kosten zijn voor de oogtest en lensmeting.
privacy
 
 
gratis product Gratis L'Oreal Nail Lacquer Colour Rich with Oil (500x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 500 deelnemers gratis L'Oreal Nail Lacquer Colour Rich with Oil uitproberen. Binnenkort kan je ook L'Oreal Men Expert Roll-On (350x), Stimorol Sugarfree Gum (500x) en Rimmel Self Tanning Cream (360x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis Zomernummer Landschap Noord-Holland
gratis producten
Maak gratis kennis met hét vernieuwde tijdschrift over de Noord-Hollandse natuur. Leer zo over het landschap en de planten/dieren die er leven.
privacy
 
 
gratis product € 100,- Shoptegoed + Kans op fantastische prijzen
geld verdienen
Ga nu (extra) meespelen met een lot in de VriendenLoterij en ontvang tijdelijk € 100,- Shoptegoed. Met dit shoptegoed kan je in de cadeaushop zelf jouw cadeaupakket samenstellen t.w.v. € 100,-. Je kiest een dagje uit voor 2 tot 4 personen, een cadeaukaart t.w.v. € 10,- (het aanbod kan wisselen: o.a. Bijenkorf, Mediamarkt, Rituals, etc.) én een boek naar keuze. Dit alles heeft een totale waarde van maximaal € 100,-. Je speelt mee zolang je zelf wilt.
privacy
 
 
gratis product Gratis 2e Entreekaartje naar keuze t.w.v. € 37,50
korting
Doe mee met dit online onderzoek naar de levensstijl van Nederlandse huishoudens. Als je het onderzoek volledig afrondt (ongeveer 10 minuten), ontvang je een kortingscode met een gemiddelde waarde van € 37,50. Te gebruiken voor een breed aanbod van musicals/theatervoorstellingen, concerten, wellness, dierentuinen en pretparken. Je kan gerust meedoen, je ontvangt namelijk geen spam/reclame via e-mail of vervelende telefoontjes.
privacy
 
 
gratis product WakaWaka Powerbank t.w.v. € 69,95 bij Visa Card
korting
De Visa World Card (€ 36,50 per jaar) is tijdens en na jouw vakantie het ideale betaalmiddel. Bovendien krijg je nu tijdelijk een WakaWaka Powerbank t.w.v. € 69,95! Dit is een krachtige, compacte oplader (bv. voor je mobiel) en (zak)lamp op zonne-energie. Vrijwel alle aankopen met de kaart zijn verzekerd, je profiteert van gratis aanvullende reisverzekeringen en je koopt veilig online met de Fraudepreventie, Internet- en Aflevergarantie. Er is ook een zakelijke kaart beschikbaar met 1e jaar geen kaartbijdrage en € 50,- cadaeu.
privacy
 
 
gratis product Gratis Groen & Fit pakket met Tekenpas
gratis producten
Vraag het gratis Groen & Fit Groen pakket van De Friesland Zorgverzekeraar aan. In het pakket zit een Groen & Fit Tekenpas, handige folder met tips en meer Groen & Fit voordelen.
privacy
 
 
gratis product Gratis 'Steun-Tibet'-pakket
gratis producten
Vraag het 'Steun-Tibet'-pakket aan en draag bij aan het vergroten van de bewustwording over de mensenrechtenschendingen in Tibet door China. Het pakket bestaat uit: Folders, Het 'Tibet Journaal', Save Tibet stickers en Actiekaarten.
privacy
 
 
gratis product Gratis Tetley Green Tea Mojito uitproberen (400x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 400 deelnemers gratis Tetley Green Tea Mojito uitproberen. Binnenkort kan je ook L'Oreal Nail Lacquer Colour Rich with Oil (500x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis informatie Zonnepanelen (zonder investering vooraf)
geld verdienen
Ontdek hoe je zonder investering vooraf jouw dak kunt voorzien van A-klasse zonnepalen. Vraag vrijblijvend meer informatie aan om € 960,- per jaar te besparen.
privacy
 
 
gratis product Maak kans op Elektrische Fiets t.w.v. € 1.699,- (2x)
winnen
Vergelijk 30 Nederlandse energieleveranciers en maak kans op één van de twee elektrische fietsen t.w.v. € 1.699,- (dames of heren).
privacy
 
 
gratis product Onbeperkt 4G-Internet & Bellen & SMS voor maar € 25,- p/m bij Tele2
korting
Vanaf vandaag start Tele2 met onbeperkt supersnel 4G-internet & bellen & sms'en, voor maar € 25,- per maand! (ook in combinatie met een toestel) Bij zowel smartphone als een sim only abonnement heb je de keus om voor maandelijks opzegbaar te kiezen. Tele2 is uitgeroepen tot 'Beste mobiele provider van 2017'.
privacy
 
 
gratis product Gratis Ultima II Lipchrome Lipstick uitproberen (450x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 450 deelnemers gratis Ultima II Lipchrome Lipstick uitproberen. Binnenkort kan je ook Tetley Green Tea Mojito (400x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Maak kans op Goossens Shoptegoed t.w.v. € 400,-
winnen
Meld je aan voor de Goossens nieuwsbrief, ontvang de laatste interieurtrends en maak kans op € 400,- shoptegoed. De winnaar wordt iedere eerste van de maand bekendgemaakt.
privacy
 
 
gratis product Gratis proefpakket Platinum Hondenvoer
gratis producten
Het gratis proefpakket van Platinum Hondenvoer bestaat uit onze drie soorten Adult voeding en een aantal Fit-Sticks Chicken+Lamb. Platinum complete voeding bestaat voor ten minste 70% uit vers vlees en ruikt en smaakt naar vlees.
privacy
 
 
gratis product Gratis Maybelline Eye Shadow Color Show (500x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 500 deelnemers gratis Maybelline Eye Shadow Color Show uitproberen. Binnenkort kan je ook Tetley Green Tea Mojito (400x) en Ultima II Lipchrome Lipstick (450x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis Flexa Kleurtester t.w.v. € 1,99
gratis producten
Maak een account aan, log in en gebruik de code rtl om een gratis Flexa Kleurtester t.w.v. € 1,99 te bestellen (als je niet ingelogd bent, werkt de code niet). Werkt de kortingscode niet meer? Probeer het dan morgen opnieuw.
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Update 9 mei: Vanwege de vele sample aanvragen zijn ze tijdelijk door de sample voorraad heen. Er gaat nog een tweede ronde komen.
privacy
 
 
gratis product Gratis Primera Spaarpas + Verschillende Cadeautjes
gratis producten
Met de gratis Primera Spaarpas spaar je Primera punten over je aankopen (verkrijgbaar in de winkel). Je spaart voor een gratis 1/5 Staatslot of de helft in contanten. Gedurende 1 jaar tijd dat wij nu lid zijn hebben wij per e-mail waardebonnen gekregen voor: gratis winkelmagenmuntje, chocolade letter, kerstkaarten, tas, Autoweek special en punten op de verjaardag.
privacy
 
 
gratis product Maak kans op een 2-daagse Brouwcursus
winnen
Geef je op om kans te maken op een 2-daagse brouwcursus bij een van de deelnemende speciaalbierbrouwerijen. Je krijgt dan een rondleiding door de brouwerij, leer je alles over smaken, geuren en kleuren, hoe je bier brouwt én wat er mis kan gaan. Ook mag je proeven en ga je zelf aan de slag.
privacy
 
 
gratis product Gratis Huismerkproducten bij Plus Klantenpanel
gratis producten
Winkel je wel eens bij de Plus Supermarkt? Dan is het Plus Klantenpanel misschien wel iets voor jou. Er zijn 4-5 onderzoeken per jaar. De beloning is een huismerkproduct of kans op Plus cadeaukaarten.
privacy
 
 
gratis product Gratis Mentos Rainbow (350x) uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquetes bij het vernieuwde Toluna. Nu kunnen 350 deelnemers gratis Mentos Rainbow uitproberen. Binnenkort kan je ook Maybelline Eye Shadow Color Show (500x) en Ultima II Lipchrome Lipstick (450x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis proefnummer OKIDO t.w.v. € 3,99
gratis producten
Benieuwd naar het spiksplinternieuwe eerste nummer van OKIDO tijdschrift? Stuur dan een mailtje naar info@okidotijdschrift.nl met jouw naam en adres. Het tijdschrift komt dan zo snel mogelijk jouw kant op. Doelgroep: Kinderen tussen de 3 en 6 jaar.
privacy
 
 
Pagina 5 van 19   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2017 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand