logo

De nieuwste gratis producten en spullen

gratis product Gratis proefpakket TENA Lady Discreet (of ander product)
gratis producten
Vraag een gratis proefpakket aan van de nieuwe TENA Lady Discreet. Voorzien van microPROTEXTM technologie, waardoor het 20% dunner is en net zo veilig. Je kan ook kiezen voor een andere TENA Lady variant (inlegkruisjes, verbanden, pants/ondergoed). Door de vraag te beantwoorden ontdek je de producten die het meest geschikt voor jou zijn. Let erop dat je ook de korte vragenlijst invult, nadat je jouw gegevens hebt bevestigd. Pas dan ontvang je het proefpakket!
privacy
 
 
gratis product Gratis Sport High Protein Recovery Bar
gratis producten
Weer beschikbaar! De Vifit Sport High Protein Recovery Bar geeft je spieren ondersteuning na het sporten. Probeer gratis een van de 3 smaken: Lemon Yoghurt, Cranberry & Peach Yoghurt. Mededeling: Ververs de pagina of probeer een andere browser als er staat dat de samples op zijn. Eventueel kan je deze link proberen of de volgende link kopiëren en plakken: https://www.vifitsport.com/nl/probeer-gratis/aanvragen
privacy
 
 
gratis product Gratis Bourjous Happy lichte Concealer uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 540 deelnemers gratis Bourjous Happy lichte Concealer uitproberen uitproberen. Binnenkort kan je ook Kleenex Origineel Mini (500x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis HEMA Cadeaukaart t.w.v. € 20,- of € 40,- bij Autoverzekering
korting
Met een HEMA Autoverzekering profiteer je van lage premies en ben je verzekerd van een prima dekking. Bereken snel en makkelijk je premie online. Bij het afsluiten/overstappen van een WA + Beperkt Casco of WA + Volledig Casco HEMA Autoverzekering krijg je nu een gratis HEMA Cadeaukaart t.w.v. € 25,- of € 40,-.
privacy
 
 
gratis product Gratis Bruna Cadeaukaart t.w.v. € 2,50 bij pakketje versturen
gratis producten
Verstuur je postpakket via PostNL bij Bruna en ontvang een Bruna Cadeaukaart t.w.v. € 2,50. Deze cadeaukaart is te besteden t/m 31 oktober 2018. Omdat de scholen weer zijn begonnen krijg je nu 50% korting op geselecteerde A-merk schoolspullen. Vanaf 20 euro wordt je bestelling gratis thuisbezorgd.
privacy
 
 
gratis product Gratis proefnummer (vernieuwde) Eva Magazine t.w.v. € 4,50
gratis producten
Eva Magazine is vernieuwd. Nu met nog meer ruimte voor eerlijke en kwetsbare verhalen, diepte-interviews, achtergronden en natuurlijk lekker veel lifestyle en fashion. Verder bijzondere en inspirerende artikelen over allerlei onderwerpen die vrouwen bezighouden, zoals geloofs- en levensvragen, maar ook rubrieken over mode, verzorging, koken, natuur en uitgaan. Vraag een gratis proefnummer aan.
privacy
 
 
gratis product 70% korting op Outdoormerken (o.a. Falke)
korting
Word gratis lid van Outdoor Exclusive en profiteer van verrassende exclusieve en onverslaanbare acties. De beste outdoormerken voor minder dan de helft van de prijs (tot 70% korting). T/m 7 november: Garmin GPS Horloge Fenix 3 HR Sapphire voor maar € 329,-, Falke 70% korting, Regatta 70% korting, Dare 2B 70% korting, Leatherman 40% korting, Sorel 55% korting en Millet 55% korting.
privacy
 
 
gratis product Gratis zakje Fisherman's Friend Mint
gratis producten
Weer beschikbaar: Kies 3 vrienden en laat ze gratis een zakje Fisherman's Friend Mint aanvragen. Daarna kan je zelf een zakje aanvragen. Er zijn 10.000 zakjes beschikbaar. Mededeling: De actie werkt mogelijk niet via een mobiel of tablet, gebruik in dat geval een laptop of vaste computer.
privacy
 
 
gratis product Mening geven bij Panel.GfKIntomart tegen een kleine vergoeding
geld verdienen
Wat vind jij van dat toetje, die rare advertentie, die nieuwe tv-serie of de laatste ontwikkelingen in onze samenleving? Je kan mee beslissen over de inhoud van bladen, televisie en radio en over welke producten verschijnen of verdwijnen bij Panel.GfKIntomart. Geef jouw mening en spaar o.a. voor Bol.com Cadeaubon, Wehkamp Cadeaubon, Coolblue Cadeaubon, Mediamarkt Cadeaubon, etc..
privacy
 
 
gratis product Gratis Waardebepaling van jouw Woning
gratis producten
Weten wat jouw woning waard is? Ontvang binnen 48-uur gratis en vrijblijvend een waardebepaling van jouw woning. Dit wordt gebaseerd op kadastergegevens verkoopgegevens, gelijkwaardige te koop staande objecten (hier kijkt de koper ook naar), rapportage Calcasa en rapportage NBWO.
privacy
 
 
gratis product Gratis Maybelline Mascara Lash Candy Glitter uitproberen
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 720 deelnemers gratis Maybelline Mascara Lash Candy Glitter uitproberen. Binnenkort kan je ook Kleenex Origineel Mini (500x) en Bourjous Happy lichte Concealer (540x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis Tony's Chocolonely Verrassing op je verjaardag
gratis producten
Steun de missie van Tony's Chocolonely om chocolade 100% slaafvrij te maken door serieus vrienden te worden. Als je jarig bent krijg je een cadeautje van de chocopostbode.
privacy
 
 
gratis product Maak een proefrit in de nieuwe Renault CAPTUR (of vraag brochure aan)
gratis producten
Maak een proefrit in de nieuwe Renault CAPTUR. Als je de brochure wilt, moet je rechtsboven (nadat je een auto hebt gekozen) op 'Brochure' klikken. Proefrit staat standaard geselecteerd. Of kies voor een ander model: Twingo, Clio, Clio Estate Kadjar, Mégane, Mégane Estate, Scénic.
privacy
 
 
gratis product Gratis sample A.Vogel Linoforce
gratis producten
Linoforce van A.Vogel is een zuiver natuurlijk middel met Lijnzaad en Sennablad. Het helpt de ontlasting zachter te maken en bevordert de natuurlijke stoelgang en darmpassage. Mededeling: Als je 00000 ziet staan, tik of klik in de adresbalk op het internetadres en druk op 'enter' (of probeer een andere browser/computer).
privacy
 
 
gratis product Niet Goed Geld Terug: Valess Burger
geld terug actie
Niet tevreden over de Valess Burger? Vraag dan je geld terug. Let op: Deze geld terug actie is alleen geldig op de Valess Burger, voorzien van actiesticker. De Valess Burger heeft een typische hamburgersmaak, is lekker mals en heeft een stevige bite. Deze actie is geldig t/m 22 december.
privacy
 
 
gratis product Gratis HEMA Cadeaubon t.w.v. € 10,- bij TrosKompas voor € 10,-
korting
Ontvang een half jaar TrosKompas TV-Magazine voor slechts € 10,- en krijg een HEMA cadeaubon t.w.v. € 10,- cadeau (als je toch al van plan was iets bij de HEMA te kopen, heb je een half jaar gratis het TrosKompas). Dit abonnement is tot wederopzegging (maand opzegtermijn). Opzeggen kan eenvoudig door een mail te sturen naar abonneeservice@troskompas.nl
privacy
 
 
gratis product Gratis officiële herslag allereerste gouden Koningin Wilhelmina 10 gulden munt uit 1892
bijna gratis
125 jaar geleden werd de allereerste Gouden Wilhelmina tien gulden munt ooit uitgegeven. Ter ere van deze gebeurtenis slaat de Hollandsche Munt een strikt gelimiteerde officiële herslag van deze gouden munt (maximaal 1.250 stuks). Je betaalt wel € 3,95 voor de verzendkosten. De extra vragen tijdens het bestellen kan je beantwoorden met: 'NEE, BEDANKT'. Leuk weetje: De originele gouden munt van 1892 kende een oplage van slechts 61 stuks en heeft momenteel een waarde van € 30.000,-!
privacy
 
 
gratis product Gratis Frank Provost Haarpoeder uitproberen (200x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 200 deelnemers gratis Frank Provost Haarpoeder uitproberen uitproberen. Binnenkort kan je ook Maybelline Mascara Lash Candy Glitter (720x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Maak kans op Unu Elektrische Snorscooter t.w.v. € 2.949,-
gratis producten
Vraag vrijblijvend informatie aan over Qurrent (groene stroom tegen inkoopprijs) en maak kans op een Unu Elektrische Snorscooter t.w.v. € 2.949,-. Als je overstapt ontvang je jouw eigen stukje windmolen (één Windtegoed t.w.v. € 55,-). Er loopt ook nog een soortgelijke actie waarbij je kans maakt op een elektrische Qwic Performance fiets t.w.v. € 2.599,-.
privacy
 
 
gratis product Lotto 3 maanden 50% korting + Kans op Reischeque € 10.000,-
korting
Je ontvangt nu 3 maanden 50% korting én je maakt kans op een reischeque t.w.v. € 10.000,- als je automatisch gaat meespelen met Lotto.
privacy
 
 
gratis product Gratis toegang Museum Boijman van Beuningen
gratis producten
Bezoekers met vuile was mogen de komende drie maanden gratis naar het museum Museum Boijmans van Beuningen in Rotterdam. Er is namelijk een wasserette geopend. Bezoekers die hun was meenemen, krijgen vrij entree en mogen hun was draaien terwijl ze het museum bezoeken (Uitleg).
privacy
 
 
gratis product Gratis proefset Avery
gratis producten
Test gratis een van de volgende producten van Avery, vraag een proefset aan van Naambadges, Adres- en verzendetiketten of Weerbestendige etiketten.
privacy
 
 
gratis product Gratis € 50,- Welkomstbonus Centraal Beheer
geld verdienen
Beginnen met beleggen? Start nu met Gemaksbeleggen bij Centraal Beheer en ontvang € 50,- welkomstbonus. De experts van Centraal Beheer houden jouw beleggingen iedere dag in de gaten. Zodat jouw geld de kans heeft om rustig te groeien. Centraal Beheer is de goedkoopste aanbieder van beleggingsfondsen.
privacy
 
 
gratis product Gratis L'Oreal Men Expert Scheer Gel (200x)
winnen
Probeer gratis nieuwe producten uit en verdien geld met enquêtes bij het vernieuwde Toluna. Nu kunnen 200 deelnemers gratis L'Oreal Men Expert Scheer Gel uitproberen. Binnenkort kan je ook Frank Provost Haarpoeder (200x) en Maybelline Mascara Lash Candy Glitter (720x) uitproberen. Nadat je bent aangemeld klik je rechtsboven op 'Ontdek' en daarna op 'Testproducten'. Maandelijks maak je ook nog eens kans op 5.000,-.
privacy
 
 
gratis product Gratis See Buy Fly Kortingsvoucher t.w.v. € 5,-
korting
Ga jij binnenkort toevallig via Schiphol op vakantie? Shop dan extra goedkoop met deze kortingsvoucher van See Buy Fly t.w.v. € 5,-.
privacy
 
 
Pagina 3 van 20   1  2  3  4  5  6  7  8  9  10  volgende >
    VEELGESTELDE VRAGENSTUUR EEN TIP INCONTACT
    COPYRIGHT © 2000 - 2017 • SITEMAPRSSLINKSPRIVACYDISCLAIMER

    rss bestand